PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G072800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 374aa    MW: 41424.6 Da    PI: 6.506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G072800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +++ +v ++G+g+W++ +++ g++R++k+c++rw +yl
  Manes.14G072800.1.p 14 RGLWTAEEDAKILAYVSKHGTGNWTALPKKAGLRRCGKSCRLRWTNYL 61
                         788*******************************************97 PP

2Myb_DNA-binding44.63.4e-1469110346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          ++T++E+el+v++++  G++ W+ Ia  ++ gRt++++k++w++
  Manes.14G072800.1.p  69 SFTPQEEELIVRLHAAIGSR-WSIIALQLP-GRTDNDVKNYWNT 110
                          79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.915965IPR017930Myb domain
SuperFamilySSF466891.68E-2911108IPR009057Homeodomain-like
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
PfamPF002497.4E-161461IPR001005SANT/Myb domain
CDDcd001672.29E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129418.20966116IPR017930Myb domain
SMARTSM007173.0E-1366114IPR001005SANT/Myb domain
PfamPF002499.6E-1369110IPR001005SANT/Myb domain
CDDcd001671.14E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MGRPPCCDKL NVKRGLWTAE EDAKILAYVS KHGTGNWTAL PKKAGLRRCG KSCRLRWTNY  60
LRPDLKHDSF TPQEEELIVR LHAAIGSRWS IIALQLPGRT DNDVKNYWNT KLRKKLSEMG  120
IDPVTHKPFS QILADYGNIG CLPKYGTRIG SLTRDLKNAF ISKPAEPTEG IITNISNHLV  180
PPKLEPIHEC FFNSKNTIST DANSNHSLDL LDQLQAIKLV TEVSSCSNCE TISDHFFKEG  240
SLSSLSSSSS SSSSTCSTAN QEKSAVNFSW RDFLLEDAFL PSDHPQEQEN AMELSSKDLT  300
NQAQNVIPQG QIGCEVTVSE RDNVGVERTE LAIPSSSFQI PSSSSASFVE AMLHQGNKNF  360
LDFPNLVEEP FSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579165.10.0PREDICTED: transcription factor MYB35
TrEMBLB9IEI51e-165B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-76MYB family protein